Immunology

Jump to Filters
View as table Download
MYL12B Rabbit Polyclonal Antibody
TA349965

USD 380.00

In Stock

Rabbit Polyclonal Anti-MYL12B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MYL12B
MYL12B Rabbit Polyclonal Antibody
TA333578

USD 539.00

5 Days

Rabbit Polyclonal Anti-MYL12B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MYL12B Antibody is: synthetic peptide directed towards the C-terminal region of Human MYL12B. Synthetic peptide located within the following region: EKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE