Immunology

Jump to Filters
View as table Download
CBS Rabbit Polyclonal Antibody
TA338394

USD 485.00

5 Days

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE
CBS Rabbit Polyclonal Antibody
TA308071

USD 625.00

2 Weeks

Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)

Applications IF, IHC, IP, WB
Reactivities Human (Predicted: Mouse, Rabbit, Rat, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520)
CBS Rabbit Polyclonal Antibody
TA349577

USD 380.00

In Stock

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CBS