Germany
Japan
United Kingdom
China
Cytokines
View as table Download
Rabbit Polyclonal Anti-CD40LG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse, Canine, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
CD40L (CD40LG) (C-term) rabbit polyclonal antibody
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human TRAP |
Rabbit Polyclonal Anti-CD40LG Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CD40LG |
CD40L (CD40LG) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human TRAP |
Rabbit Polyclonal TNFA Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Rabbit anti CD154 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to aa 51-69 of human CD154. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Clonalities
- Polyclonal
Families
- Transmembrane
Pathways
- T cell receptor signaling pathway