Autoimmunity

Jump to Filters
View as table Download
IL1F10 Rabbit Polyclonal Antibody
TA326664

USD 570.00

5 Days

Rabbit Polyclonal IL-1F10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-1F10 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human IL-1F10.
IL1F10 Rabbit Polyclonal Antibody
TA342892

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL1F10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL1F10 antibody: synthetic peptide directed towards the middle region of human IL1F10. Synthetic peptide located within the following region: SRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEA