Autoimmunity

View as table Download

Anti-IL18RAP Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 378-599 amino acids of human interleukin 18 receptor accessory protein

Anti-IL18RAP Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 378-599 amino acids of human interleukin 18 receptor accessory protein

Rabbit Polyclonal Anti-IL18RAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL18RAP antibody: synthetic peptide directed towards the N terminal of human IL18RAP. Synthetic peptide located within the following region: NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKC