Autoimmunity

Jump to Filters
View as table Download
STK19 Rabbit Polyclonal Antibody
TA337952

USD 539.00

5 Days

Rabbit Polyclonal Anti-STK19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STK19 antibody is: synthetic peptide directed towards the middle region of Human STK19. Synthetic peptide located within the following region: PPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTE
STK19 Rabbit Polyclonal Antibody
TA362853

USD 539.00

5 Days

STK19 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N region of human STK19