Autoimmunity

View as table Download

Rabbit Polyclonal Anti-CEBPB Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CEBPB

Rabbit polyclonal C/EBP-beta (Ab-235/188) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human C/EBP-β around the phosphorylation site of threonine 235 (P-G-T-P-S).

Rabbit Polyclonal C/EBP- beta (Thr235/188) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human C/EBP- beta around the phosphorylation site of Threonine 235/188
Modifications Phospho-specific

Rabbit Polyclonal Anti-CEBPB Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CEBPB antibody: synthetic peptide directed towards the N terminal of human CEBPB. Synthetic peptide located within the following region: AIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDL

Rabbit Polyclonal C/EBP-beta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human C/EBP-beta

CEBP Beta (CEBPB) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human CEBPB

Rabbit polyclonal anti-CEBPB antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CEBPB.

Rabbit Polyclonal anti-CEBPB antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CEBPB antibody: synthetic peptide directed towards the C terminal of human CEBPB. Synthetic peptide located within the following region: ADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKS

Rabbit Polyclonal Anti-CEBPB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CEBPB Antibody: A synthesized peptide derived from human CEBPB

CEBPB Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CEBPB