Autoimmunity

Jump to Filters
View as table Download
IL36RN Rabbit Polyclonal Antibody
TA326668

USD 570.00

5 Days

Rabbit Polyclonal IL-36RN Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen IL-36RN antibody was raised against a 19 amino acid peptide near the carboxy terminus of human IL-36RN.
IL36RN Rabbit Polyclonal Antibody
TA370475

USD 380.00

4 Weeks

IL36RN rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human IL36RN
IL36RN Rabbit Polyclonal Antibody
TA372772

USD 380.00

4 Weeks

IL36RN rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL36RN
IL36RN Rabbit Polyclonal Antibody
TA330956

USD 539.00

5 Days

Rabbit polyclonal Anti-IL1F5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL1F5 antibody: synthetic peptide directed towards the middle region of human IL1F5. Synthetic peptide located within the following region: LTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
IL36RN Rabbit Polyclonal Antibody
TA366121

USD 380.00

4 Weeks

IL36RN rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human IL36RN