Anti-IL18RAP Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 378-599 amino acids of human interleukin 18 receptor accessory protein |
Anti-IL18RAP Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 378-599 amino acids of human interleukin 18 receptor accessory protein |
Anti-IL18RAP Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 378-599 amino acids of human interleukin 18 receptor accessory protein |
IL18R Beta (IL18RAP) (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human IL18RAP |
Rabbit Polyclonal IL-18 R beta/IL-1 R7/ACPL Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a region within amino acids 50-150 of human IL-18 Receptor accessory protein/IL-18 RA/AcPL was used immunogen. |
Rabbit Polyclonal Anti-IL18RAP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL18RAP antibody: synthetic peptide directed towards the N terminal of human IL18RAP. Synthetic peptide located within the following region: NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKC |