Germany
Japan
United Kingdom
China
Adaptive Immunity
View as table Download
Rabbit Polyclonal Anti-FUCA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FUCA1 Antibody: synthetic peptide directed towards the middle region of human FUCA1. Synthetic peptide located within the following region: TNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPL |
FUCA1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Conjugation | Unconjugated |
| Immunogen | Alpha-L-Fucosidase is isolated and purified from Bovine kidney. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
FUCA1 rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Conjugation | Biotin |
| Immunogen | Alpha-L-Fucosidase is isolated and purified from Bovine kidney. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
FUCA1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Conjugation | Unconjugated |
| Immunogen | Alpha-L-Fucosidase is isolated and purified from Bovine kidney. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-FUCA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FUCA1 Antibody: synthetic peptide directed towards the N terminal of human FUCA1. Synthetic peptide located within the following region: PSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPLYLL |
Active filters
Target Symbol
- FUCA1