PDE3B mouse monoclonal antibody,clone OTI3F5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PDE3B mouse monoclonal antibody,clone OTI3F5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDE3B mouse monoclonal antibody,clone OTI3F5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
PDE3B mouse monoclonal antibody,clone OTI3F5, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
PDE3B mouse monoclonal antibody,clone OTI3F5, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
PDE3B (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 400-427 amino acids from the Central region of Human PDE3B |
Rabbit Polyclonal Anti-PDE3B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDE3B antibody: synthetic peptide directed towards the middle region of human PDE3B. Synthetic peptide located within the following region: SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN |
PDE3B mouse monoclonal antibody,clone OTI3F5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".