Germany
Japan
United Kingdom
China
USD 509.00
2 Weeks
CLOCK mouse monoclonal antibody, clone OTI2B12 (formerly 2B12), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
Adaptive Immunity
View as table Download
CLOCK mouse monoclonal antibody, clone OTI2B12 (formerly 2B12), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
CLOCK mouse monoclonal antibody, clone OTI2H7 (formerly 2H7)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CLOCK mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CLOCK mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CLOCK mouse monoclonal antibody, clone OTI4A6 (formerly 4A6)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CLOCK mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CLOCK mouse monoclonal antibody, clone OTI4E12 (formerly 4E12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-CLOCK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLOCK antibody: synthetic peptide directed towards the N terminal of human CLOCK. Synthetic peptide located within the following region: LFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFN |
Rabbit anti-CLOCK polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
Rabbit Polyclonal Anti-Clock Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Clock Antibody: A synthesized peptide derived from human Clock |
CLOCK mouse monoclonal antibody, clone OTI1C10 (formerly 1C10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CLOCK mouse monoclonal antibody, clone OTI2B12 (formerly 2B12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- CLOCK
Pathways
- Circadian rhythm - mammal