Adaptive Immunity

Jump to Filters
View as table Download
CLOCK Rabbit Polyclonal Antibody
TA312928

USD 380.00

In Stock

Rabbit polyclonal anti-Clock antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human Clock.
CLOCK Rabbit Polyclonal Antibody
TA334241

USD 539.00

5 Days

Rabbit Polyclonal Anti-CLOCK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLOCK antibody: synthetic peptide directed towards the N terminal of human CLOCK. Synthetic peptide located within the following region: LFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFN
CLOCK Rabbit Polyclonal Antibody
TA310045

USD 360.00

3 Weeks

Rabbit anti-CLOCK polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH
CLOCK Rabbit Polyclonal Antibody
TA347532

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Clock Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Clock Antibody: A synthesized peptide derived from human Clock