CAV1 mouse monoclonal antibody,clone OTI2C4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CAV1 mouse monoclonal antibody,clone OTI2C4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CAV1 mouse monoclonal antibody,clone OTI2C4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
CAV1 mouse monoclonal antibody,clone OTI2C4, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
CAV1 mouse monoclonal antibody,clone OTI2C4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Goat Polyclonal Anti-CAV1 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human CAV1 produced in E. coli. |
CAV1 mouse monoclonal antibody,clone OTI2C4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Mouse Monoclonal Antibody against Caveolin 1 (7C8)
Applications | FC, ICC/IF, IHC, Immunoblotting, IP, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CAV1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CAV1 |
Rabbit polyclonal Caveolin-1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caveolin-1. |
Rabbit Polyclonal Anti-CAV1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CAV1 antibody: synthetic peptide directed towards the N terminal of human CAV1. Synthetic peptide located within the following region: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEID |
USD 430.00
3 Weeks
Caveolin 1 (CAV1) (1-104) mouse monoclonal antibody, clone AT4C1, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 315.00
3 Weeks
Caveolin 1 (CAV1) (1-104) mouse monoclonal antibody, clone AT4C1, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against Caveolin 1
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DELSEKQVYDAH, from the internal region of the protein sequence according to NP_001744.2. |
Rabbit Polyclonal Caveolin-1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Caveolin-1 |
Rabbit Polyclonal Caveolin-1 (Tyr14) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Caveolin-1 around the phosphorylation site of Tyrosine 14 |
Modifications | Phospho-specific |