Adaptive Immunity

View as table Download

Carrier-free (BSA/glycerol-free) POLR2A mouse monoclonal antibody,clone OTI3C8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

POLR2A mouse monoclonal antibody,clone OTI3C8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

POLR2A mouse monoclonal antibody,clone OTI2B7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

POLR2A mouse monoclonal antibody,clone OTI3C8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Carrier-free (BSA/glycerol-free) POLR2A mouse monoclonal antibody,clone OTI2B7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

POLR2A mouse monoclonal antibody,clone OTI2B7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

POLR2A mouse monoclonal antibody,clone OTI1E5

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) POLR2A mouse monoclonal antibody,clone OTI1E5

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

POLR2A mouse monoclonal antibody,clone OTI1E5

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Mouse Monoclonal RNA polymerase II Antibody (4H8)

Applications ChIP, CyTOF-ready, ELISA, FC, ICC/IF, IP, WB
Reactivities Human, Mouse, Yeast
Conjugation Unconjugated

Rabbit polyclonal POLR2A (Ab-1619) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human POLR2A around the phosphorylation site of serine 1619 (P-T-S-P-S).

POLR2A Rabbit Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human POLR2A

Rabbit Polyclonal Anti-POLR2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR2A antibody is: synthetic peptide directed towards the N-terminal region of Human POLR2A. Synthetic peptide located within the following region: DNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQ

POLR2A (794-822) mouse monoclonal antibody, clone ARNA-3, Supernatant

Applications IF, IHC, WB
Reactivities Drosophila, Human
Conjugation Unconjugated