Germany
Japan
United Kingdom
China
Adaptive Immunity
View as table Download
PTEN mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
| Reactivities | Human |
| Conjugation | Unconjugated |
PTEN mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTEN mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTEN mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)
| Reactivities | Human |
| Conjugation | Unconjugated |
PTEN mouse monoclonal antibody,clone 1C3, Biotinylated
| Reactivities | Human |
| Conjugation | Biotin |
PTEN mouse monoclonal antibody,clone 1C3, HRP conjugated
| Reactivities | Human |
| Conjugation | HRP |
PTEN mouse monoclonal antibody,clone 2H9, Biotinylated
| Reactivities | Human |
| Conjugation | Biotin |
PTEN mouse monoclonal antibody,clone 2H9, HRP conjugated
| Reactivities | Human |
| Conjugation | HRP |
Rabbit Polyclonal Anti-INPP5K Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF |
Active filters
Category
- Antibodies
Families
- Phosphatase
Pathways
- Inositol phosphate metabolism