Adaptive Immunity

Jump to Filters
View as table Download
PPP3CB Rabbit Polyclonal Antibody
TA308439

USD 625.00

2 Weeks

Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Chicken, Rabbit, Rat, Xenopus, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298)
SHP1 (PTPN6) Rabbit Polyclonal Antibody
TA321535

USD 380.00

In Stock

Anti-PTPN6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 244-515 amino acids of human protein tyrosine phosphatase, non-receptor type 6
SHP2 (PTPN11) Rabbit Polyclonal Antibody
TA321538

USD 380.00

In Stock

Anti-PTPN11 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human protein tyrosine phosphatase, non-receptor type 11
Calcineurin A (PPP3CA) Rabbit Polyclonal Antibody
TA349733

USD 380.00

In Stock

Rabbit Polyclonal Anti-PPP3CA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PPP3CA
PPP3R2 (N-term) Rabbit Polyclonal Antibody
AP53423PU-N

USD 580.00

2 Weeks

PPP3R2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 9~29 amino acids from the N-terminal region of Human PPP3R2 / CBLP
Calcineurin A (PPP3CA) Rabbit Polyclonal Antibody
TA339198

USD 539.00

5 Days

Rabbit Polyclonal Anti-PPP3CA

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP3CA antibody: synthetic peptide directed towards the middle region of human PPP3CA. Synthetic peptide located within the following region: LPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINE
SHP2 (PTPN11) Rabbit Polyclonal Antibody
TA326255

USD 380.00

4 Weeks

Rabbit polyclonal SH-PTP2 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human SH-PTP2.
SHP2 (PTPN11) Rabbit Polyclonal Antibody
TA890142

USD 407.00

In Stock

Rabbit Polyclonal anti-PTPN11 Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PTPN11
PPP3CC (N-term) Rabbit Polyclonal Antibody
AP53421PU-N

USD 580.00

2 Weeks

PPP3CC (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 17-45 amino acids from the N-terminal region of Human PPP3CC
SHP2 (PTPN11) Rabbit Polyclonal Antibody
TA302214

USD 580.00

5 Days

Rabbit Polyclonal Antibody against PTPN11

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SHP2 antibody is generated from rabbits immunized with a recombinant protein of partial human SHP2.
SHP2 (PTPN11) Rabbit Polyclonal Antibody
TA306351

USD 570.00

5 Days

Rabbit Polyclonal SHP2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SHP2 antibody was raised against a 14 amino acid peptide from near the amino terminus of human SHP2.
SHP1 (PTPN6) Rabbit Polyclonal Antibody
TA327048

USD 365.00

3 Weeks

Rabbit anti-PTPN6 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PTPN6
SHP1 (PTPN6) Rabbit Polyclonal Antibody
TA326179

USD 380.00

In Stock

Rabbit polyclonal SHP-1 (Phospho-Tyr564) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human SHP-1 around the phosphorylation site of tyrosine 564 (D-V-YP-E-N).
Modifications Phospho-specific
SHP1 (PTPN6) Rabbit Polyclonal Antibody
TA327802

USD 380.00

In Stock

Rabbit Polyclonal Phospho-SHP-1 (Tyr536) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SHP-1 around the phosphorylation site of Tyrosine 536
Modifications Phospho-specific
Calcineurin A (PPP3CA) Rabbit Polyclonal Antibody
TA339197

USD 539.00

5 Days

Rabbit Polyclonal Anti-PPP3CA

Applications WB
Reactivities Mouse, Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP3CA antibody: synthetic peptide directed towards the N terminal of human PPP3CA. Synthetic peptide located within the following region: MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHL