Rabbit Polyclonal Anti-TRPM4 Antibody
| Applications | WB |
| Reactivities | Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRPM4 antibody: synthetic peptide directed towards the N terminal of human TRPM4. Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI |
Rabbit polyclonal anti-TRPV1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TRPV1 |
Anti-TRPV4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 237-465 amino acids of human transient receptor potential cation channel, subfamily V, member 4 |
Rabbit Polyclonal Anti-TRPA1 Antibody
| Applications | IHC, WB |
| Reactivities | Rat, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRPA1 antibody: synthetic peptide directed towards the middle region of human TRPA1. Synthetic peptide located within the following region: KCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLAL |
Anti-TRPM1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 806-820 amino acids of human transient receptor potential cation channel, subfamily M, member 1 |
Anti-TRPC3 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 823-836 amino acids of human transient receptor potential cation channel, subfamily C, member 3 |
Anti-TRPM7 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1850-1863 amino acids of human transient receptor potential cation channel, subfamily M, member 7 |
Anti-TRPM7 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1850-1863 amino acids of human transient receptor potential cation channel, subfamily M, member 7 |
Anti-TRPV4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 237-465 amino acids of human transient receptor potential cation channel, subfamily V, member 4 |
Anti-TRPC3 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 834-846 amino acids of human transient receptor potential cation channel, subfamily C, member 3 |
Rabbit polyclonal antibody to TRPM2 (transient receptor potential cation channel, subfamily M, member 2)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 181 and 423 of TRPM2 (Uniprot ID#O94759) |
Rabbit Polyclonal Antibody against TRPM8 (C-term)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Rat) |
| Conjugation | Unconjugated |
| Immunogen | This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1075-1104 amino acids from the C-terminal region of human TRPM8. |
Rabbit Polyclonal Anti-Trpv6 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Trpv6 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC |
Germany
Japan
United Kingdom
China
