Germany
Japan
United Kingdom
China
Endosomal Marker Antibodies
View as table Download
Rabbit Polyclonal Anti-CAV1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAV1 antibody: synthetic peptide directed towards the N terminal of human CAV1. Synthetic peptide located within the following region: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEID |
Rabbit Polyclonal Caveolin-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caveolin-1 |
Rabbit Polyclonal Caveolin-1 (Tyr14) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caveolin-1 around the phosphorylation site of Tyrosine 14 |
| Modifications | Phospho-specific |
Caveolin 1 (CAV1) (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide from C-terminal domain of human caveolin-1 |
Rabbit Polyclonal Anti-CAV1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAV1 antibody: synthetic peptide directed towards the N terminal of human CAV1. Synthetic peptide located within the following region: SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDL |
Rabbit Polyclonal Anti-Caveolin-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Caveolin-1 Antibody: A synthesized peptide derived from human Caveolin-1 |
Rabbit Polyclonal Anti-Caveolin 1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Caveolin 1 Antibody: A synthesized peptide derived from human Caveolin 1 |
Active filters
Antibody Hosts
- Rabbit
Families
- Druggable Genome
Pathways
- Viral myocarditis