Cytoskeleton Marker Antibodies

View as table Download

Rabbit Polyclonal Anti-NKX2-3 Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Nkx2-3 antibody: synthetic peptide directed towards the c terminal of mouse Nkx2-3. Synthetic peptide located within the following region: AAAYSGSYGCAYPTGGGGGGGGTASAATTAMQPACSATGGGSFVNVSNLG

Rabbit Polyclonal Anti-NKX2

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NKX2-3 Antibody: synthetic peptide directed towards the N terminal of human NKX2-3. Synthetic peptide located within the following region: ADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKLSYLNSLAAADGHG

Rabbit Polyclonal Anti-NKX2-3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NKX2-3 antibody: synthetic peptide directed towards the middle region of mouse NKX2-3. Synthetic peptide located within the following region: GTHAPPPPPRRVAVPVLVRDGKPCVTPSAQTYGSPYGVGAGAYSYNSFPA