Cytoskeleton Marker Antibodies

View as table Download

Rabbit polyclonal ENOA Antibody (N-term)

Applications FC, IF, WB
Reactivities Human, Mouse (Predicted: Bovine, Monkey)
Conjugation Unconjugated
Immunogen This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA.

Rabbit Polyclonal Anti-ENO1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ENO1

Rabbit polyclonal ENO1 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Bovine, Chicken, Monkey, Xenopus)
Conjugation Unconjugated
Immunogen This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1.

Rabbit Polyclonal antibody to ENO1 (enolase 1, (alpha))

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Chimpanzee, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 199 and 434 of ENO1 (Uniprot ID#P06733)

Rabbit anti-ENO1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human ENO1

Rabbit Polyclonal Anti-ENO1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP

Rabbit Polyclonal Anti-ENO1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK

Rabbit Polyclonal Anti-ENO1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: GSGGMTHSDQPKEDRQGVNEKSCNCLLLKVNQIGSVTESLQACKLAQANG

Non Neuronal Enolase (ENO1) mouse monoclonal antibody, clone NSE-P1, Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-ENO1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELR