USD 447.00
In Stock
METAP2 (Methionine Aminopeptidase 2) mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
METAP2 (Methionine Aminopeptidase 2) mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) METAP2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
5 Days
METAP2 mouse monoclonal antibody,clone 1F6, Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
5 Days
METAP2 mouse monoclonal antibody,clone 1F6, HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 200.00
2 Days
METAP2 (Methionine Aminopeptidase 2) mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-METAP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-METAP2 antibody: synthetic peptide directed towards the N terminal of human METAP2. Synthetic peptide located within the following region: ATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGR |