Germany
Japan
United Kingdom
China
Cytoskeleton Marker Antibodies
View as table Download
Rabbit Polyclonal beta-Actin Antibody
| Applications | Block/Neutralize, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Avian, Hamster |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709]. |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Drosophila) |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit Polyclonal antibody to beta Actin (actin, beta)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Rat, Dog, Rabbit, Chicken, Sheep, Chimpanzee, Bovine, Guinea Pig, Rhesus Monkey, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 309 and 358 of beta Actin |
Rabbit polyclonal MAPK3 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3. |
Rabbit polyclonal MAPK1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human MAPK1. |
Rabbit Polyclonal antibody to gamma Actin (actin, gamma 1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Xenopus, Chicken, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 375 of gamma Actin |
Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204 |
| Modifications | Phospho-specific |
Rabbit polyclonal MAPK1 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 254-285 amino acids from the C-terminal region of human MAPK1. |
Rabbit polyclonal MAP2K7 (Ab-271) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A). |
Active filters
Category
- Antibodies
Reactivities
- Human
Antibody Hosts
- Rabbit
Pathways
- Adherens junction