Centrosome Marker Antibodies

View as table Download

Anti-MAP2K1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 15-28 amino acids of human mitogen-activated protein kinase kinase 1

Rabbit polyclonal Plk1 phospho T210 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-Polo-like Kinase pT210 Antibody was produced by repeated immunizations with a synthetic phospho peptide corresponding to aa 205-214 of Human Polo-like kinase 1 (Plk1) protein.

PLK1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PLK1

Rabbit anti-CDK1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Center-peptide of human CDK1

Rabbit polyclonal anti-CDK2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CDK2.

Rabbit polyclonal CDK1/CDC2 (Thr14) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CDK1/CDC2 around the phosphorylation site of threonine 14 (E-G-TP-Y-G).
Modifications Phospho-specific

Rabbit polyclonal CDC2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CDC2.

Rabbit anti-MEK1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen C term -peptide of human MEK1

Rabbit Polyclonal Anti-CDK1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM

Rabbit Polyclonal Anti-MAP2K1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MAP2K1

Rabbit Polyclonal Anti-PLK1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PLK1

Rabbit polyclonal anti-cdk2 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Anti-cdk2 antbody was prepared from whole rabbit serum by repeated immunizations with a synthetic peptide corresponding to the C-terminus of the human cdk-2 protein conjugated to Keyhole Limpet Hemocyanin (KLH).

Rabbit anti CDC2 (pY15) (CDK1) Polyclonal Antibody

Applications Dot, WB
Reactivities Human, Chicken, Bovine
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding to the epitope -GTYGV- with a phosphorylation site at Tyr15 of human CDC2 protein. This sequence is identical among human, mouse, rat, bovine and chicken species.

Rabbit anti CDC2 (Paired Y15) (CDK1) Polyclonal Antibody

Applications Dot, WB
Reactivities Human, Chicken, Bovine
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding to the epitope -GTYGV- without a phosphorylation site at Tyr15 of human CDC2 protein. This sequence is identical among human, mouse, rat, bovine and chicken species.

Rabbit anti CDC2 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Chicken, Bovine
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of CDC2 protein from human, rat and mouse origins