Germany
Japan
United Kingdom
China
Centrosome Marker Antibodies
View as table Download
Rabbit polyclonal CDK1/CDC2 (Thr14) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDK1/CDC2 around the phosphorylation site of threonine 14 (E-G-TP-Y-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDK1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
Rabbit polyclonal anti-cdk2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Anti-cdk2 antbody was prepared from whole rabbit serum by repeated immunizations with a synthetic peptide corresponding to the C-terminus of the human cdk-2 protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit anti CDC2 (pY15) (CDK1) Polyclonal Antibody
| Applications | Dot, WB |
| Reactivities | Human, Chicken, Bovine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -GTYGV- with a phosphorylation site at Tyr15 of human CDC2 protein. This sequence is identical among human, mouse, rat, bovine and chicken species. |
Rabbit anti CDC2 (Paired Y15) (CDK1) Polyclonal Antibody
| Applications | Dot, WB |
| Reactivities | Human, Chicken, Bovine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -GTYGV- without a phosphorylation site at Tyr15 of human CDC2 protein. This sequence is identical among human, mouse, rat, bovine and chicken species. |
Rabbit polyclonal CDK2 (Ab-160) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDK2 around the phosphorylation site of Threonine160. |
Rabbit Polyclonal CDC2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC2 |
Rabbit Polyclonal CDK1/CDC2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CDK1/CDC2 |
Rabbit Polyclonal CDK2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CDK2 |
Rabbit Polyclonal CDK1/CDC2 (Thr14) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CDK1/CDC2 around the phosphorylation site of Threonine 14 |
| Modifications | Phospho-specific |
Rabbit Polyclonal CDK2 (Thr160) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CDK2 around the phosphorylation site of Threonine 160 |
| Modifications | Phospho-specific |
Active filters
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Protein Kinase
Pathways
- p53 signaling pathway