Germany
Japan
United Kingdom
China
Centrosome Marker Antibodies
View as table Download
Rabbit Polyclonal MAP2K1IP1/MAPKSP1 Antibody
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A genomic peptide made to an internal region of the human MAP2K1IP1 protein (within residues 20-180). [Swiss-Prot Q9UHA4] |
Rabbit Polyclonal antibody to GCP2 (tubulin, gamma complex associated protein 2)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 226 of GCP2 (Uniprot ID#Q9BSJ2) |
Rabbit Polyclonal antibody to MP1 (MAPK scaffold protein 1)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 124 of MP1 (Uniprot ID#Q9UHA4) |
Rabbit Polyclonal Anti-RAD51 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RAD51 Antibody: synthetic peptide directed towards the N terminal of human RAD51. Synthetic peptide located within the following region: ANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILVMAERYGLS |
Rabbit Polyclonal Anti-GNAI1 Antibody
| Applications | WB |
| Reactivities | Mouse, Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAI1 antibody: synthetic peptide directed towards the middle region of human GNAI1. Synthetic peptide located within the following region: YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH |
Active filters
Reactivities
- Mouse
Clonalities
- Polyclonal
Families
- Druggable Genome
Filter by
Category
Target Symbol
Applications
Antibody Hosts
Conjugates
Modifications
Pathways
- Pathways in cancer (70)
- Prostate cancer (61)
- Melanogenesis (55)
- Progesterone-mediated oocyte maturation (53)
- Colorectal cancer (52)
- Endometrial cancer (52)
- Focal adhesion (52)
- Thyroid cancer (52)
- Oocyte meiosis (50)
- Gap junction (39)
- Leukocyte transendothelial migration (32)
- Pancreatic cancer (32)
- Tight junction (32)
- Adherens junction (29)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (29)
- Basal cell carcinoma (29)
- Cell cycle (29)
- Pathogenic Escherichia coli infection (29)
- Wnt signaling pathway (29)
- Chemokine signaling pathway (26)
- Long-term depression (26)
- MAPK signaling pathway (25)
- Acute myeloid leukemia (23)
- B cell receptor signaling pathway (23)
- Bladder cancer (23)
- Chronic myeloid leukemia (23)
- Dorso-ventral axis formation (23)
- ErbB signaling pathway (23)
- Fc epsilon RI signaling pathway (23)
- Fc gamma R-mediated phagocytosis (23)
- Glioma (23)
- GnRH signaling pathway (23)
- Insulin signaling pathway (23)
- Long-term potentiation (23)
- Melanoma (23)
- Natural killer cell mediated cytotoxicity (23)
- Neurotrophin signaling pathway (23)
- Non-small cell lung cancer (23)
- Prion diseases (23)
- Regulation of actin cytoskeleton (23)
- Renal cell carcinoma (23)
- T cell receptor signaling pathway (23)
- Toll-like receptor signaling pathway (23)
- VEGF signaling pathway (23)
- Vascular smooth muscle contraction (23)
- p53 signaling pathway (22)
- Homologous recombination (12)
- Alzheimer's disease (10)
- Parkinson's disease (10)
- Small cell lung cancer (9)
- Axon guidance (3)
- Cytokine-cytokine receptor interaction (1)
- Jak-STAT signaling pathway (1)