Germany
Japan
United Kingdom
China
Centrosome Marker Antibodies
View as table Download
Rabbit Polyclonal MAP2K1IP1/MAPKSP1 Antibody
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A genomic peptide made to an internal region of the human MAP2K1IP1 protein (within residues 20-180). [Swiss-Prot Q9UHA4] |
Rabbit Polyclonal antibody to GCP2 (tubulin, gamma complex associated protein 2)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 226 of GCP2 (Uniprot ID#Q9BSJ2) |
Rabbit Polyclonal antibody to MP1 (MAPK scaffold protein 1)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 124 of MP1 (Uniprot ID#Q9UHA4) |
Rabbit Polyclonal Anti-RAD51 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RAD51 Antibody: synthetic peptide directed towards the N terminal of human RAD51. Synthetic peptide located within the following region: ANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILVMAERYGLS |
Active filters
Reactivities
- Mouse
Applications
- IHC
Clonalities
- Polyclonal
Families
- Druggable Genome
Filter by
Category
Target Symbol
Antibody Hosts
Conjugates
Modifications
Pathways
- Pathways in cancer (31)
- Prostate cancer (26)
- Colorectal cancer (24)
- Endometrial cancer (24)
- Focal adhesion (24)
- Melanogenesis (24)
- Oocyte meiosis (24)
- Progesterone-mediated oocyte maturation (24)
- Thyroid cancer (24)
- Pancreatic cancer (18)
- Gap junction (17)
- MAPK signaling pathway (15)
- Acute myeloid leukemia (13)
- B cell receptor signaling pathway (13)
- Bladder cancer (13)
- Chemokine signaling pathway (13)
- Chronic myeloid leukemia (13)
- Dorso-ventral axis formation (13)
- ErbB signaling pathway (13)
- Fc epsilon RI signaling pathway (13)
- Fc gamma R-mediated phagocytosis (13)
- Glioma (13)
- GnRH signaling pathway (13)
- Insulin signaling pathway (13)
- Long-term depression (13)
- Long-term potentiation (13)
- Melanoma (13)
- Natural killer cell mediated cytotoxicity (13)
- Neurotrophin signaling pathway (13)
- Non-small cell lung cancer (13)
- Prion diseases (13)
- Regulation of actin cytoskeleton (13)
- Renal cell carcinoma (13)
- T cell receptor signaling pathway (13)
- Toll-like receptor signaling pathway (13)
- VEGF signaling pathway (13)
- Vascular smooth muscle contraction (13)
- Adherens junction (11)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (11)
- Basal cell carcinoma (11)
- Cell cycle (11)
- Leukocyte transendothelial migration (11)
- Pathogenic Escherichia coli infection (11)
- Tight junction (11)
- Wnt signaling pathway (11)
- Homologous recombination (7)
- p53 signaling pathway (6)
- Alzheimer's disease (2)
- Parkinson's disease (2)
- Small cell lung cancer (2)
- Cytokine-cytokine receptor interaction (1)
- Jak-STAT signaling pathway (1)