Germany
Japan
United Kingdom
China
Assay Kits
View as table Download
USD 458.00
In Stock
USD 494.00
In Stock
PTCH1 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence from the C Terminus of Human PTCH1 (NP_001077073.1, NP_001077074.1, NP_001077075.1, NP_001077076.1) |
WNT3 (315-329) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Human, Mouse, Rat, Bovine, Bat, Chicken, Equine, Monkey, Porcine, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from an internal region of human WNT3 |
USD 494.00
In Stock
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
USD 458.00
In Stock
Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001457.1. |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
USD 458.00
In Stock
Active filters
Pathways
- Basal cell carcinoma
Filter by
Category
Target Symbol
Reactivities
Applications
Antibody Hosts
Clonalities
Conjugates
Assay Types
Assay Platforms
Families
- Druggable Genome (25)
- ES Cell Differentiation/IPS (19)
- Transcription Factors (11)
- Secreted Protein (10)
- Transmembrane (9)
- Cancer stem cells (7)
- Adult stem cells (6)
- Induced pluripotent stem cells (6)
- Stem cell relevant signaling - Wnt Signaling pathway (4)
- Embryonic stem cells (3)
- Stem cell - Pluripotency (3)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (3)
- GPCR (1)
- Stem cell relevant signaling - DSL/Notch pathway (1)