Assay Kits

View as table Download

Smoothened (SMO) (N-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SMO antibody was raised against synthetic peptide - KLH conjugated

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

APC2 rabbit polyclonal antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen APC2 antibody was raised against synthetic peptide - KLH conjugated

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP

BMP2 (+ BMP4) rabbit polyclonal antibody, Purified

Applications ELISA, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly purified Synthetic peptide C-terminal (20 amino acids) of Human BMP-2/4.