Purified BIRC5/Survivin mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700032 |
Purified BIRC5/Survivin mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700032 |
purified MYC mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700496 |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
purified MYC mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700497 |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
USD 494.00
In Stock
MYC biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Matched ELISA Pair | TA600496 |
USD 494.00
In Stock
MYC biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Matched ELISA Pair | TA600497 |
USD 494.00
In Stock
BIRC5/Survivin biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Biotin |
Matched ELISA Pair | TA600032 |
BCL2 (1-211) mouse monoclonal antibody, clone AT1B5, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
BCL2 (1-211) mouse monoclonal antibody, clone AT1B5, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Conjugation | Unconjugated |
Immunogen | This antibody was purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. |
Purified BIRC5/Survivin mouse monoclonal capture antibody, validated for ELISA assays
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700033 |
c-Myc (MYC) chicken polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%. |
c-Myc (MYC) rabbit polyclonal antibody, Biotin
Applications | ELISA, IHC, WB |
Conjugation | Biotin |
Immunogen | Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc. |
Rabbit Polyclonal Bcl2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |