Germany
Japan
United Kingdom
China
ELISA Kits
View as table Download
WNT3 (315-329) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Human, Mouse, Rat, Bovine, Bat, Chicken, Equine, Monkey, Porcine, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from an internal region of human WNT3 |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001457.1. |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
BMP2 mouse monoclonal antibody, clone AT15B3, Purified
| Applications | ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
BMP2 mouse monoclonal antibody, clone AT15B3, Purified
| Applications | ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 425.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Pathways
- Basal cell carcinoma
Filter by
Target Symbol
Reactivities
Antibody Hosts
Clonalities
Conjugates
Assay Types
Families
- Druggable Genome (13)
- ES Cell Differentiation/IPS (7)
- Secreted Protein (7)
- Transmembrane (7)
- Adult stem cells (5)
- Cancer stem cells (5)
- Induced pluripotent stem cells (5)
- Embryonic stem cells (3)
- Stem cell - Pluripotency (3)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (3)
- Transcription Factors (3)
- Stem cell relevant signaling - Wnt Signaling pathway (2)
- GPCR (1)
- Stem cell relevant signaling - DSL/Notch pathway (1)