ELISA Kits

Jump to Filters
View as table Download
c-Jun (JUN) Rabbit Polyclonal Antibody
TA590119

USD 482.00

In Stock

Rabbit Polyclonal c-jun Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
JNK1 (MAPK8) (318-427) Mouse Monoclonal Antibody [Clone ID: 3H2]
AM31931PU-N

USD 535.00

2 Weeks

JNK1 (MAPK8) (318-427) mouse monoclonal antibody, clone 3H2, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
PKC alpha (PRKCA) (pan) Rabbit Polyclonal Antibody
AP06566PU-N

USD 465.00

3 Weeks

PKC alpha (PRKCA) (pan) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 470-520 of Human PKC-pan.
WNT3 (315-329) Goat Polyclonal Antibody
AP22539PU-N

USD 555.00

2 Weeks

WNT3 (315-329) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Canine, Human, Mouse, Rat, Bovine, Bat, Chicken, Equine, Monkey, Porcine, Xenopus, Zebrafish
Conjugation Unconjugated
Immunogen Synthetic peptide from an internal region of human WNT3
PPAR delta (PPARD) (430-441) Goat Polyclonal Antibody
AP23032PU-N

USD 500.00

2 Weeks

PPAR delta (PPARD) (430-441) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Synthetic peptide from the C-terminus of human PPARD
WNT3A Mouse Monoclonal Antibody [Clone ID: 3A6]
AM09053PU-N

USD 430.00

3 Weeks

WNT3A mouse monoclonal antibody, clone 3A6, Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
NFAT2 (NFATC1) Mouse Monoclonal Antibody [Clone ID: AT1C3]
AM09061PU-N

USD 430.00

3 Weeks

NFAT2 (NFATC1) mouse monoclonal antibody, clone AT1C3, Purified

Applications ELISA, FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
NFAT2 (NFATC1) Mouse Monoclonal Antibody [Clone ID: AT1C3]
AM09061PU-S

USD 315.00

3 Weeks

NFAT2 (NFATC1) mouse monoclonal antibody, clone AT1C3, Purified

Applications ELISA, FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
p53 (TP53) Rabbit Polyclonal Antibody
TA329146

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
WNT3A Mouse Monoclonal Antibody [Clone ID: 3A6]
AM09053PU-S

USD 315.00

3 Weeks

WNT3A mouse monoclonal antibody, clone 3A6, Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
APC2 Rabbit Polyclonal Antibody
AP23515PU-N

USD 500.00

2 Weeks

APC2 rabbit polyclonal antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen APC2 antibody was raised against synthetic peptide - KLH conjugated
Frizzled 2 (FZD2) Goat Polyclonal Antibody
AP22449PU-N

USD 520.00

5 Days

Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_001457.1.
p53 (TP53) Rabbit Polyclonal Antibody
TA329142

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP
c-Myc (MYC) Rabbit Polyclonal Antibody
R1182

USD 525.00

2 Weeks

c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Conjugation Unconjugated
Immunogen This antibody was purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide.
PRKACA (N-term) Rabbit Polyclonal Antibody
AP17667PU-N

USD 580.00

2 Weeks

PRKACA (N-term) rabbit polyclonal antibody

Applications ELISA, FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 67-94 amino acids from the N-terminal(K282) region of human PRKACA