Antibodies

Jump to Filters
View as table Download
Olfactory Marker Protein (OMP) Rabbit Polyclonal Antibody
TA345161

USD 539.00

5 Days

Rabbit Polyclonal Anti-OMP Antibody - middle region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-OMP antibody: synthetic peptide directed towards the middle region of human OMP. Synthetic peptide located within the following region: WRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKA
Olfactory Marker Protein (OMP) (N-term) Rabbit Polyclonal Antibody
AP52997PU-N

USD 580.00

2 Weeks

Olfactory Marker Protein (OMP) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 12-41 amino acids from the N-terminal region of Human Olfactory marker protein