Olfactory Marker Protein (OMP) Rabbit Polyclonal Antibody

CAT#: TA345161

Rabbit Polyclonal Anti-OMP Antibody - middle region

Product Images

WB Suggested Anti-OMP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: OMP; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml; OMP is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OMP antibody: synthetic peptide directed towards the middle region of human OMP. Synthetic peptide located within the following region: WRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: olfactory marker protein
• Database Link:
  NP_006180
  Entrez Gene 24612 RatEntrez Gene 4975 Human
  UniProt ID P47874
• Background: Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Results of the mouse knockout studies show that OMP- mice are compromised in their ability to respond to odor stimuli, and that OMP represents a novel modulatory component of the odor detection/signal transduction cascade. [provided by RefSeq, Jul 2008]
• Synonyms: olfactory marker protein
• Note: Immunogen Sequence Homology: Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%

Reference Data

• Protein Families: Druggable Genome