Antibodies

View as table Download

Rabbit Polyclonal Anti-CAV3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CAV3

Goat Anti-CAV3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence EHTDLEAQIVKDIH-C, from the N Terminus of the protein sequence according to NP_203123.1.

Rabbit Polyclonal Anti-CAV3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAV3 antibody: synthetic peptide directed towards the N terminal of human CAV3. Synthetic peptide located within the following region: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVG

Caveolin 3 (CAV3) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human CAV3