Antibodies

View as table Download

Rabbit polyclonal anti-CAPN11 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CAPN11.

Rabbit Polyclonal Anti-CAPN11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAPN11 antibody: synthetic peptide directed towards the N terminal of human CAPN11. Synthetic peptide located within the following region: NNSRLKAKGVGQHDNAQNFGNQSFEELRAACLRKGELFEDPLFPAEPSSL