Antibodies

Jump to Filters
View as table Download
Clusterin (CLU) Mouse Monoclonal Antibody [Clone ID: OTI5D3]
TA808665

USD 447.00

In Stock

CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Clusterin (CLU) Mouse Monoclonal Antibody [Clone ID: OTI5D3]
CF808665

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Clusterin (CLU) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D3]
TA808665AM

USD 509.00

2 Weeks

CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin
Clusterin (CLU) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D3]
TA808665BM

USD 509.00

2 Weeks

CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP
Clusterin (CLU) Mouse Monoclonal Antibody [Clone ID: OTI5D3]
TA808665S

USD 200.00

2 Days

CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Clusterin (CLU) Mouse Monoclonal Antibody [Clone ID: OTI2A7]
CF808578

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) CLU mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human
Conjugation Unconjugated
Clusterin (CLU) Rabbit Polyclonal Antibody
TA351991

USD 380.00

In Stock

Rabbit Polyclonal Anti-CLU Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLU
TA351991 is a possible alternative to TA321404.
Clusterin (CLU) (N-term) Rabbit Polyclonal Antibody
AP50979PU-N

USD 580.00

2 Weeks

Clusterin (CLU) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 71-99 amino acids from the N-terminal region of human CLU
Clusterin (CLU) Mouse Monoclonal Antibody [Clone ID: OTI2A7]
TA808578S

USD 200.00

In Stock

CLU mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Clusterin (CLU) (488-501) Goat Polyclonal Antibody
AP22475PU-N

USD 555.00

2 Weeks

Clusterin (CLU) (488-501) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Canine, Human, Monkey
Conjugation Unconjugated
Immunogen Synthetic peptide from the C-terminus of human CLU/Clusterin (NP_001822.2; NP_976084.1).
Clusterin (CLU) (Alpha) Rabbit Polyclonal Antibody
AP20482PU-N

USD 465.00

3 Weeks

Clusterin (CLU) (Alpha) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Clusterin (CLU) Rabbit Polyclonal Antibody
TA343117

USD 539.00

5 Days

Rabbit Polyclonal Anti-CLU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLU antibody: synthetic peptide directed towards the C terminal of human CLU. Synthetic peptide located within the following region: CREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLN