Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 509.00
2 Weeks
GGPS1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-GGPS1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GGPS1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GGPS1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
GGPS1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
GGPS1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 509.00
2 Weeks
Anti-GGPS1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
Anti-GGPS1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
GGPS1 (N-term) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human GGPS1. |
GGPS1 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human GGPS1. |
Rabbit Polyclonal Anti-GGPS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GGPS1 antibody: synthetic peptide directed towards the middle region of human GGPS1. Synthetic peptide located within the following region: LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- GGPS1