Antibodies

Jump to Filters
View as table Download
ZNF312B (FEZF1) Rabbit Polyclonal Antibody
TA339647

USD 539.00

5 Days

Rabbit Polyclonal Anti-FEZF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FEZF1 antibody: synthetic peptide directed towards the C terminal of human FEZF1. Synthetic peptide located within the following region: CPTCGKGFCRNFDLKKHVRKLHDSSLGLARTPAGEPGTEPPPPLPQQPPM
ZNF312B (FEZF1) (N-term) Rabbit Polyclonal Antibody
AP51648PU-N

USD 580.00

2 Weeks

ZNF312B (FEZF1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 67-96 amino acids from the N-terminal region of human FEZF1