Antibodies

Jump to Filters
View as table Download
MIF (C-term) Rabbit Polyclonal Antibody
AP23265PU-N

USD 560.00

2 Weeks

MIF (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a sequence at the C-terminal of human MIF
MIF Goat Polyclonal Antibody
TA303028

USD 520.00

5 Days

Goat Polyclonal Antibody against MIF

Applications WB
Reactivities Human (Expected from sequence similarity: Rat, Mouse)
Conjugation Unconjugated
Immunogen Peptide with sequence C-NAANVGWNNSTFA, from the C Terminus of the protein sequence according to NP_002406.1.
MIF Rabbit Polyclonal Antibody
TA327040

USD 365.00

3 Weeks

Rabbit anti-MIF Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MIF
MIF Rabbit Polyclonal Antibody
TA337663

USD 539.00

5 Days

Rabbit Polyclonal Anti-MIF Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MIF antibody: synthetic peptide directed towards the middle region of human MIF. Synthetic peptide located within the following region: PQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLL