USD 447.00
In Stock
CYP26B1 mouse monoclonal antibody,clone OTI4A8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
CYP26B1 mouse monoclonal antibody,clone OTI4A8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) CYP26B1 mouse monoclonal antibody,clone OTI4A8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
CYP26B1 mouse monoclonal antibody,clone OTI4A8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
CYP26B1 mouse monoclonal antibody,clone OTI4A8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Cytochrome P450 26B (CYP26B1) (160-396) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 160 and 396 of Human Cytochrome P450 26B |
Cytochrome P450 26B (CYP26B1) (418-430) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Canine, Human, Mouse, Rat, Equine, Hamster, Monkey, Rabbit |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from an internal region of human CYP26B1 |
Rabbit Polyclonal Anti-CYP26B1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP26B1 antibody: synthetic peptide directed towards the N terminal of human CYP26B1. Synthetic peptide located within the following region: LRWAATRDKSCKLPIPKGSMGFPLIGETGHWLLQGSGFQSSRREKYGNVF |
Goat Anti-CYP26B1 Antibody
Applications | IHC |
Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SQARSEDKDGRFH, from the internal region of the protein sequence according to NP_063938.1. |
Rabbit Polyclonal Anti-CYP26B1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP26B1 antibody: synthetic peptide directed towards the middle region of human CYP26B1. Synthetic peptide located within the following region: SRFELATRTFPRITLVPVLHPVDGLSVKFFGLDSNQNEILPETEAMLSAT |
CYP26B1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CYP26B1 |
USD 200.00
2 Days
CYP26B1 mouse monoclonal antibody,clone OTI4A8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".