Antibodies

View as table Download

Carrier-free (BSA/glycerol-free) CYP26B1 mouse monoclonal antibody,clone OTI4A8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Cytochrome P450 26B (CYP26B1) (160-396) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 160 and 396 of Human Cytochrome P450 26B

Cytochrome P450 26B (CYP26B1) (418-430) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Canine, Human, Mouse, Rat, Equine, Hamster, Monkey, Rabbit
Conjugation Unconjugated
Immunogen Synthetic peptide from an internal region of human CYP26B1

Rabbit Polyclonal Anti-CYP26B1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP26B1 antibody: synthetic peptide directed towards the N terminal of human CYP26B1. Synthetic peptide located within the following region: LRWAATRDKSCKLPIPKGSMGFPLIGETGHWLLQGSGFQSSRREKYGNVF

Goat Anti-CYP26B1 Antibody

Applications IHC
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-SQARSEDKDGRFH, from the internal region of the protein sequence according to NP_063938.1.

Rabbit Polyclonal Anti-CYP26B1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP26B1 antibody: synthetic peptide directed towards the middle region of human CYP26B1. Synthetic peptide located within the following region: SRFELATRTFPRITLVPVLHPVDGLSVKFFGLDSNQNEILPETEAMLSAT

CYP26B1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CYP26B1