Germany
Japan
United Kingdom
China
Mouse monoclonal Hsp70/Hsc70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Drosophila, Fish, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus, Beluga, Hamster, Guinea Pig, C. elegans |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit polyclonal MAPK1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human MAPK1. |
Rabbit Polyclonal Anti-Egr1 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Egr1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQV |
USD 590.00
2 Weeks
Rabbit Polyclonal Antibody against HSPA1A (Y41)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat, Zebrafish, Bovine, Chicken, Drosophila, Hamster, Pig, Monkey, Xenopus, Yeast, C. elegans) |
| Conjugation | Unconjugated |
| Immunogen | This HSPA1A/HSPA1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-48 amino acids from human HSPA1A/HSPA1B. |
Rabbit Polyclonal Antibody against MAP2K1 (S217)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat, Chicken, Drosophila, Hamster, Rabbit, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This MEK1(MAP2K1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 196-225 amino acids from human MEK1(MAP2K1). |
Mouse monoclonal Erk2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine, Xenopus) |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Xenopus
Pathways
- Prion diseases