Rabbit Polyclonal Anti-GPR37 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | PAEL Receptor / GPR37 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human GPR37. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (95%); Marmoset (90%); Rabbit (85%); Panda (80%). |
Rabbit polyclonal Pael-R (GPR37) Antibody (N-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Pael-R (GPR37) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-126 amino acids from the N-terminal region of human Pael-R (GPR37). |
Rabbit polyclonal anti-GPR37 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR37. |
Rabbit Polyclonal Anti-GPR37 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR37 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR37. Synthetic peptide located within the following region: KIRKAEKACTRGNKRQIQLESQMNCTVVALTILYGFCIIPENICNIVTAY |
GPR37 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GPR37 |
Germany
Japan
United Kingdom
China
