Germany
Japan
United Kingdom
China
USD 447.00
In Stock
Antibodies
View as table Download
USD 600.00
3 Days
USD 509.00
2 Weeks
USD 509.00
2 Weeks
USD 447.00
In Stock
AMT mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 447.00
In Stock
AMT mouse monoclonal antibody, clone OTI5D12 (formerly 5D12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) AMT mouse monoclonal antibody, clone OTI5D12 (formerly 5D12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) AMT mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
AMT mouse monoclonal antibody, clone OTI4C9 (formerly 4C9), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 509.00
2 Weeks
AMT mouse monoclonal antibody, clone OTI4C9 (formerly 4C9), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 509.00
2 Weeks
AMT mouse monoclonal antibody, clone OTI5D12 (formerly 5D12), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 509.00
2 Weeks
AMT mouse monoclonal antibody, clone OTI5D12 (formerly 5D12), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 200.00
2 Days
AMT mouse monoclonal antibody, clone OTI6F4 (formerly 6F4)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Aminomethyltransferase (AMT) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human AMT |
Rabbit Polyclonal Anti-AMT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMT Antibody: synthetic peptide directed towards the N terminal of human AMT. Synthetic peptide located within the following region: QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- AMINOMETHYLTRANSFERASE
Pathways
- One carbon pool by folate