Rabbit Polyclonal anti-NR5A1 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR5A1 antibody: synthetic peptide directed towards the middle region of human NR5A1. Synthetic peptide located within the following region: AVPGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGP |
Rabbit Polyclonal Anti-NR5A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR5A1 antibody: synthetic peptide directed towards the middle region of human NR5A1. Synthetic peptide located within the following region: PGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGPNV |
Rabbit Polyclonal Anti-NR5A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR5A1 antibody: synthetic peptide directed towards the middle region of human NR5A1. Synthetic peptide located within the following region: SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA |
Germany
Japan
United Kingdom
China
