Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-OPTN Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human OPTN |
Optineurin Rabbit Polyclonal (aa575-591) Antibody
| Applications | IHC |
| Reactivities | Bat, Dog, Gorilla, Human, Monkey, Mouse, Rabbit, Rat, Gibbon, Horse, Orang-Utan (Predicted: Hamster) |
| Conjugation | Unconjugated |
| Immunogen | OPTN / Optineurin antibody was raised against synthetic peptide corresponding to aa 559-575 (GEVLPDIDTLQIHVMDC) of human, mouse and rat optineurin |
Rabbit Polyclonal Anti-OPTN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OPTN antibody: synthetic peptide directed towards the N terminal of human OPTN. Synthetic peptide located within the following region: LSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERS |
Rabbit Polyclonal Anti-OPTN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OPTN Antibody: synthetic peptide directed towards the C terminal of human OPTN. Synthetic peptide located within the following region: SDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII |
Rabbit Polyclonal Anti-OPTN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OPTN antibody: synthetic peptide directed towards the N terminal of human OPTN. Synthetic peptide located within the following region: SHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTEN |
Active filters
Target Symbol
- OPTINEURIN
Isotypes
- IgG