Antibodies

Jump to Filters
View as table Download
UQCRQ Rabbit Polyclonal Antibody
TA334394

USD 539.00

5 Days

Rabbit Polyclonal Anti-UQCRQ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UQCRQ antibody is: synthetic peptide directed towards the middle region of Human UQCRQ. Synthetic peptide located within the following region: KGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK
UQCRQ Rabbit Polyclonal Antibody
TA365484

USD 380.00

4 Weeks

UQCRQ rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
UQCRQ Rabbit Polyclonal Antibody
TA369793

USD 380.00

4 Weeks

UQCRQ rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
UQCRQ Rabbit Polyclonal Antibody
TA383130

USD 365.00

3 Weeks

UQCRQ Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-82 of human UQCRQ (NP_055217.2).
Modifications Unmodified