Antibodies

Jump to Filters
View as table Download
PGK2 Rabbit Polyclonal Antibody
TA349588

USD 380.00

In Stock

Rabbit Polyclonal Anti-PGK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PGK2
PGK2 Rabbit Polyclonal Antibody
TA335403

USD 539.00

5 Days

Rabbit Polyclonal Anti-PGK2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PGK2 Antibody: synthetic peptide directed towards the C terminal of human PGK2. Synthetic peptide located within the following region: ITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM