Rabbit Polyclonal Anti-Tmem260 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-6720456H20Rik Antibody is: synthetic peptide directed towards the middle region of Mouse 6720456H20Rik. Synthetic peptide located within the following region: LFRLLKEKELTLSLLLRLTLAFSAGLLPYVYLPVSSYLSRARWTWGDQTT |
Rabbit Polyclonal Anti-TMEM260 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C14ORF101 Antibody: synthetic peptide directed towards the N terminal of human C14ORF101. Synthetic peptide located within the following region: WGDQTTLQGFLTHFLREEYGTFSLAKSEIGSSMSEILLSQVTNMRTELSF |
Germany
Japan
United Kingdom
China