Germany
Japan
United Kingdom
China
USD 570.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Equine, Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
USD 315.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Equine, Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal MUC-1 Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal CXCR7/RDC-1 Antibody
| Applications | FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding amino acids 106-129 of human CXCR7/RDC1 was used as the immunogen, GenBank NP_064707.1. |
XPR1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Bovine, Bat, Canine, Chicken, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic 16 amino acid peptide from the N-terminal cytoplasmic domain of human XPR1. |
WNT3 (315-329) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Human, Mouse, Rat, Bovine, Bat, Chicken, Equine, Monkey, Porcine, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from an internal region of human WNT3 |
Rabbit Polyclonal GRAIL/RNF128 Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Canine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids portion of amino acids 227-269 of human GRAIL was used as immunogen, GenBank no. NP_919445.1. |
Activin Receptor Type IA (ACVR1) (147-161) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Human, Mouse, Rat, Bovine, Bat, Equine, Monkey, Porcine, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from an internal region of human ACVR1 |
DAP12 (TYROBP) (Internal) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human, Bat, Canine, Equine, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide C-KQRITETESPYQE from an internal region of human TYROBP / DAP12 (NP_003323.1; NP_937758.1) |
USD 500.00
2 Weeks
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (Internal) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human, Bovine, Canine, Chicken, Equine, Monkey, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from an internal region of human CHRNA7 (NP_000737.1) |
NKCC1 (SLC12A2) (769-783) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Canine, Human, Mouse, Rat, Chicken, Equine, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from an internal region of human SLC12A2 / NKCC1 (NP_001037.1) |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Equine
Families
- Transmembrane
Filter by
Target Symbol
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Assay Types
Pathways
- Calcium signaling pathway (2)
- Nitrogen metabolism (2)
- Toll-like receptor signaling pathway (2)
- Vibrio cholerae infection (2)
- Basal cell carcinoma (1)
- Cytokine-cytokine receptor interaction (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- Hedgehog signaling pathway (1)
- Huntington's disease (1)
- Lysosome (1)
- Melanogenesis (1)
- Metabolic pathways (1)
- Natural killer cell mediated cytotoxicity (1)
- Neuroactive ligand-receptor interaction (1)
- Oxidative phosphorylation (1)
- Parkinson's disease (1)
- Pathways in cancer (1)
- TGF-beta signaling pathway (1)
- Wnt signaling pathway (1)